PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011090046.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 326aa    MW: 36137.8 Da    PI: 8.4877
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011090046.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1314.1e-41171248178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cq+egC+adl++ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+q+
  XP_011090046.1 171 RCQAEGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSQQ 248
                     6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.4E-35166233IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.308169246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.89E-38170247IPR004333Transcription factor, SBP-box
PfamPF031109.5E-31172245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MLDYGWGNPS SIMLSAEENA QDSEPNRPVF DPYATHPFSE TANFVNPEPH FAAVPHHHIP  60
FHHPQTPNSN THFSTFYDSR AYTASASSYP HPHQAPPASM LTLEPAAPTG FMVVPKSEPM  120
VGGLEFNAEY NSRIGLNLGG RTYFASSEDD FVNRLYRRSR ILEPGSVNSP RCQAEGCNAD  180
LTHAKHYHRR HKVCEFHSKA ATVIAAGLTQ RFCQQCSRFH LLSEFDNGKR SCRKRLADHN  240
RRRRKSQQLS NQENNNNKSQ LENNAPNSSS ENLTRSPPDS GAHSSSVTVA ISPPRISLDC  300
FGHRSYTGGT TSSTASTSSL FYSSKG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-31164245384squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090046.10.0PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL39e-85SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A075FEV51e-166A0A075FEV5_SALMI; SQUAM
STRINGPGSC0003DMT4000749761e-119(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48462341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.17e-83squamosa promoter binding protein-like 8